Profile picture

Arkadiusz Kulpa

AI & ML Engineer

HomeAboutBlogChat
Profile picture

Arkadiusz Kulpa

AI & ML Engineer

HomeAboutBlogChat

Moving API Credentials to AWS Secrets Manager for Zero-Downtime Rotation

2026-03-176 min read
awssecrets-managerapi-designarchitecturenextjsdevlog

I moved the Blog API's service credentials from Amplify env vars to AWS Secrets Manager — eliminating the need to redeploy after credential changes.

Read more →

Fixing the MDEditor Ghost Text and Adding a Media Gallery Download

2026-03-125 min read
cmsadmin-uitypescriptdevlog

I diagnosed and fixed a double-text overlay bug in the markdown editor caused by CSS layering, and added a download button to the admin media gallery.

Read more →

Fixing the Blog Reading Experience: TOC Sidebar and Scroll Behaviour

2026-03-065 min read
cssresponsive-designnextjstypescriptdevlog

I fixed the table of contents sidebar breakpoint, anchor scroll offset for the fixed navbar, and improved IntersectionObserver scroll-spy on blog posts.

Read more →

Building a Media Upload Pipeline with S3 Presigned URLs and CDN Delivery

2026-03-055 min read
s3cdngraphqllambdamedia-uploadawsnextjsdevlog

I built a media upload system using S3 presigned URLs for secure browser-to-S3 uploads and CDN-backed delivery, with custom blogimage and BlogPDF components.

Read more →

Taming Responsive Layout with CSS Design Tokens and Fluid Scaling

2026-02-255 min read
cssresponsive-designdesign-tokensnextjsarchitecturedevlog

I replaced ad-hoc media queries with a CSS design token system using clamp() for fluid scaling — fixing a 'grow then shrink' responsive bug in the process.

Read more →

Building a REST API So Claude Can Write My Blog Posts

2026-02-215 min read
rest-apiapi-designcognitolambdanextjstypescriptdevlog

I built REST API endpoints on top of my blog's GraphQL backend so an LLM agent can programmatically create, update, and publish posts via curl.

Read more →

From Static Markdown to a Full CMS: Rebuilding the Blog Backend

2026-02-196 min read
dynamodbs3graphqlcognitolambdacmsisrnextjsarchitecturedevlog

I replaced the static markdown blog with a full CMS backed by S3, DynamoDB, AppSync GraphQL, and a custom admin UI with a rich markdown editor.

Read more →

How Real LLM Response Streaming Works

2025-11-2528 min read
portfolio upgradestreamingaiarchitecture

A technical deep dive into building low-latency AI response streaming on AWS - from failed REST API and SSE attempts to a production WebSocket solution with Lambda, LangGraph, and MLflow.

Read more →

Static vs Streaming Responses: A Deep Dive into Real-time AI Chat Architecture

2025-08-246 min read
portfolio upgradestreamingaiarchitecture

From fake typing effects to real streaming challenges - our journey implementing and then removing streaming responses in a Next.js + AWS Lambda + Bedrock architecture.

Read more →

Adding an AI Chat Assistant with RAG to My Portfolio

2025-08-205 min read
aws-bedrockpineconeraglambdadynamodbnextjsdevlog

I integrated AWS Bedrock with Pinecone vector search to give my portfolio an AI assistant that answers questions about my work using retrieval-augmented generation.

Read more →

Building MyAI4: A Next-Generation AI-First Streaming Platform

2025-06-1511 min read
aiawsbedrockarchitecture

Discover how I architected MyAI4, an AI-first streaming platform with unified intelligence, advanced family controls, and deep content analysis—leveraging serverless AWS infrastructure and multi-agent AI to deliver personalized, cross-domain recommendations and rapid service expansion.

Read more →

Building the Foundation: A Next.js Portfolio from Scratch

2025-06-015 min read
nextjstypescriptaws-amplifyarchitecturedevlog

How I built my portfolio site from the ground up with Next.js, TypeScript, and AWS Amplify — complete with a static blog, table of contents, and PDF viewer.

Read more →

Back to Basics Practice

2025-03-242 min read
pythonfundamentals

Returning to coding and model creation after a break from work demands.

Read more →

Databricks RAG LLM – MVP Project (Apprenticeship EPA)

2025-01-243 min read
airagdatabricksllm

Complete project presentation showcasing the development of a Retrieval-Augmented Generation (RAG) system using Large Language Models on Databricks platform - my capstone project for AI Data Specialist Level 7 apprenticeship.

Read more →

TensorFlow Time Series Forecasting in Financial Services

2024-06-214 min read
data-sciencetensorflowdeep-learning

Advanced machine learning approaches for time series forecasting and anomaly detection in financial markets, demonstrating the application of TensorFlow and deep learning techniques to protect against market manipulation and identify trading anomalies.

Read more →

TensorFlow Deep Learning Neural Network for Fraud Detection

2024-04-164 min read
data-sciencetensorflowdeep-learning

Advanced deep learning neural network implementation for fraud detection in financial services, demonstrating enterprise-grade machine learning solutions using TensorFlow, AWS SageMaker, and cloud computing architectures for share registrar and pension services.

Read more →

AI Innovation – ChatGPT API app

2024-02-052 min read
aipythonchatgpt

Applicability of an AI Chat Assistant in resolving knowledge compartmentalization within a workplace.

Read more →

Data Science Project - Automated Excel Test Schedule with Azure DevOps APIs

2023-10-127 min read
data-sciencepython

Enterprise-grade automation solution developed at Equiniti combining Excel, Azure DevOps APIs, Python analytics, and Power Query to transform manual testing workflows into intelligent, automated reporting systems for large-scale project management.

Read more →

Welcome to my Portfolio Page!

2023-07-021 min read
portfolio upgradenextjsawsarchitecture

Starting to write down my projects in blog / post style.

Read more →

Tags